RetrogeneDB ID: | retro_mluc_2267 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL430165:472580..472803(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDDC1 | ||
Ensembl ID: | ENSMLUG00000017584 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 66.23 % |
Parental protein coverage: | 57.25 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | GVSAQSFLHCFTLASAAFNLQVAT-PGGKTMDFVDVSESNARWVQDFR-LKAYASPAKLESIDGARYHAL |
GV.AQ.FLH.F.LA.AA.NLQVA...GGKT.D.V.VSE.NARWV..FR..KA.ASPA.L.S.D.AR..AL | |
Retrocopy | GVTAQAFLHGFQLAGAALNLQVAG<AGGKTLDSVGVSERNARWVRAFR<PKA*ASPAILGSTDVARCRAL |
Parental | LIPSCPG |
L.PS.PG | |
Retrocopy | LTPSRPG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Macropus eugenii | ENSMEUG00000005033 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000017584 | 1 retrocopy |
retro_mluc_2267 ,
|
Mus musculus | ENSMUSG00000051007 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000046382 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000003122 | 1 retrocopy |