RetrogeneDB ID: | retro_mputfur_863 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
Coordinates: | GL896961.1:5878447..5878659(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SPINK2 | ||
Ensembl ID: | ENSMPUG00000004749 | ||
Aliases: | None | ||
Description: | serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) [Source:HGNC Symbol;Acc:11245] |
Percent Identity: | 61.11 % |
Parental protein coverage: | 78.89 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | GGSMALSAVRLVLLLLAADLAASLDSLSSEFD-QPSEYRTPNCNQYKLPGCPRDFSPVCGSDMSTYPNEC |
GGSMA.......LL....DLA.SLDS.....D.QPSE.RT.NC.QYK.PGCPRD.S..CG.DMS.YPN.C | |
Retrocopy | GGSMAVLVLHVALLFPDRDLAVSLDSELLSVD<QPSECRTSNCDQYK*PGCPRDLSAGCGKDMSAYPNQC |
Parental | TL |
TL | |
Retrocopy | TL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000014129 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000004749 | 1 retrocopy |
retro_mputfur_863 ,
|