RetrogeneDB ID: | retro_oana_105 | ||
Retrocopy location | Organism: | Platypus (Ornithorhynchus anatinus) | |
| Coordinates: | Ultra239:4123815..4124025(-) | ||
| Located in intron of: | ENSOANG00000003539 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOANG00000028755 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_oana_105
ATGTTTCCTATGGAGCACTTCAATACTGGAATAAGTGCCATACTTAATAATTCAGGATTTTCATCAGAATTACTACTTCC
AACAGATGGCCCATACCTTCAAATAATATAGGAACCTAAACAGAGAGGATTTCATTTCCATTATGTTTGCAAAGGACCGT
CCCATGACAGTCTTCCAGGTGCTTCTAGTGGAAAGAACAAAAAAATGTAC
ORF - retro_oana_105 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 81.69 % |
| Parental protein coverage: | 78.89 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | MFPMEHFNIGISAILNNSGFSSELPLTTADGPYLQIIEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKS |
| MFPMEHFN.GISAILNNSGFSSEL.L.T.DGPYLQII..PKQRGF.F.YVC.GPSH..LPGASS.KNKK. | |
| Retrocopy | MFPMEHFNTGISAILNNSGFSSELLLPT-DGPYLQII*EPKQRGFHFHYVCKGPSHDSLPGASSGKNKKM |
| Parental | Y |
| Y | |
| Retrocopy | Y |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .09 RPM | 0 .44 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .33 RPM |
| SRP007412_heart | 0 .09 RPM | 0 .27 RPM |
| SRP007412_kidney | 0 .00 RPM | 2 .37 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .18 RPM |
| SRP007412_testis | 0 .12 RPM | 2 .73 RPM |
Ornithorhynchus anatinus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_oana_105 retrocopy.
Ornithorhynchus anatinus was not studied using FANTOM5 data.
retro_oana_105 was not experimentally validated.
Retrocopy orthology:
Ornithorhynchus anatinus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ornithorhynchus anatinus | ENSOANG00000028755 | 1 retrocopy |
retro_oana_105 ,
|