RetrogeneDB ID: | retro_obar_35 | ||
Retrocopy location | Organism: | Oryza barthii | |
| Coordinates: | 9:11994936..11995158(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | OBART01G15350 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.35 % |
| Parental protein coverage: | 92.5 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | LEHPIFSANCLKMLRAPTNLVQSLLWEPGMECTREKVINFHSNLVIHRLMNVIKDRKDNKLRRFTHLTRT |
| ...PIF..............................VIN.HSNLVIH.LMNVIKD.KDNKLRRFTHLTRT | |
| Retrocopy | IRFPIFGRSVCVGFQTLVRFTWNISYSHDLDNYFQLVINLHSNLVIHLLMNVIKD*KDNKLRRFTHLTRT |
| Parental | KQVQ |
| KQVQ | |
| Retrocopy | KQVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Oryza barthii | OBART01G15350 | 1 retrocopy |
retro_obar_35 ,
|