RetrogeneDB ID: | retro_omer_27 | ||
Retrocopylocation | Organism: | Oryza meridionalis | |
Coordinates: | 11:12982600..12982801(+) | ||
Located in intron of: | OMERI11G10420 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | OMERI01G18000 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 50.75 % |
Parental protein coverage: | 55.83 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | KIASSRSRRVAGSSTSRIRAKKKYLSFKTVHTHEEPRNRFRPAAAAGRLPEAGSSGGRGVERRRDLR |
K..S...R.VA.SS..........L......T.EEPR.RFR.AAAAGRLPEAGSSG.R..E.R...R | |
Retrocopy | KFQSQLLRAVASSSIDWRLERG*WLGLAWR*TYEEPRERFRQAAAAGRLPEAGSSGRREEEQRCERR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Oryza meridionalis | OMERI01G18000 | 1 retrocopy |
retro_omer_27 ,
|