RetrogeneDB ID: | retro_onil_36 | ||
Retrocopylocation | Organism: | Tilapia (Oreochromis niloticus) | |
Coordinates: | GL831144.1:4885337..4885502(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSONIG00000018945 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 52.73 % |
Parental protein coverage: | 56.12 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | YAEQQWGQSICLVDPALDGDLCYGLEVGATSKSFHVVLRQQGRTDSIESFVCVEC |
YAEQQWGQSI.LVDP.LDGDLCY.LEVG.................SI.S.....C | |
Retrocopy | YAEQQWGQSIFLVDPRLDGDLCYWLEVGLSKEPHAQMPACSPHATSIKS*ITISC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Oreochromis niloticus | ENSONIG00000018945 | 1 retrocopy |
retro_onil_36 ,
|