RetrogeneDB ID: | retro_pabe_1841 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 21:26171065..26171472(+) | ||
Located in intron of: | ENSPPYG00000011304 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FDX1 | ||
Ensembl ID: | ENSPPYG00000003853 | ||
Aliases: | None | ||
Description: | ferredoxin 1 [Source:HGNC Symbol;Acc:3638] |
Percent Identity: | 65.71 % |
Parental protein coverage: | 75.54 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | GGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACE-GTLAC |
GGS...S.....S..A.SSSEDKITVHFIN........KGKV.DSLLDVVVENN.DIDGF.A...G.L.. | |
Retrocopy | GGSTGVSQR*NTSVKAQSSSEDKITVHFINQQ*NI--NKGKVDDSLLDVVVENNVDIDGFVAWQ<GNLGL |
Parental | STCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGK |
..CHL.FE..I.EKLD.IT..E.DMLDLAYGLTDRS.L.CQICLTKSM..MTV.VP..VA.ARQS.D.GK | |
Retrocopy | -LCHLNFEKYIFEKLDTITEKETDMLDLAYGLTDRSELYCQICLTKSMGHMTV*VPDGVASARQSTDMGK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .97 RPM |
SRP007412_cerebellum | 0 .00 RPM | 5 .47 RPM |
SRP007412_heart | 0 .06 RPM | 8 .82 RPM |
SRP007412_kidney | 0 .07 RPM | 15 .28 RPM |
SRP007412_liver | 0 .03 RPM | 55 .82 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2501 |
Gorilla gorilla | retro_ggor_1560 |
Pan troglodytes | retro_ptro_1452 |
Callithrix jacchus | retro_cjac_2028 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010395 | 1 retrocopy | |
Homo sapiens | ENSG00000137714 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000022443 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007249 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017826 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000003853 | 2 retrocopies |
retro_pabe_1822, retro_pabe_1841 ,
|
Pan troglodytes | ENSPTRG00000004260 | 2 retrocopies |