RetrogeneDB ID: | retro_pabe_2122 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 2b:63686845..63687057(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LY6E | ||
Ensembl ID: | ENSPPYG00000018927 | ||
Aliases: | None | ||
Description: | lymphocyte antigen 6 complex, locus E [Source:HGNC Symbol;Acc:6727] |
Percent Identity: | 57.53 % |
Parental protein coverage: | 54.96 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MKIFLPVLLAALLGVER-ASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSK |
MK.FLP.LLAA.LGV.R.A..L....C.NQ.SNL.CLKPTICS..D...V..SA..GIG.....GH.L.K | |
Retrocopy | MKVFLPALLAAFLGVGR<ARLLVHCCCTNQNSNLCCLKPTICSHEDRPYVNMSA-VGIGSVMDIGHILNK |
Parental | TCS |
.CS | |
Retrocopy | GCS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .28 RPM |
SRP007412_cerebellum | 0 .00 RPM | 15 .32 RPM |
SRP007412_heart | 0 .00 RPM | 7 .22 RPM |
SRP007412_kidney | 0 .00 RPM | 10 .74 RPM |
SRP007412_liver | 0 .00 RPM | 10 .80 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000021460 | 2 retrocopies | |
Mus musculus | ENSMUSG00000022587 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000018927 | 1 retrocopy |
retro_pabe_2122 ,
|
Tursiops truncatus | ENSTTRG00000001986 | 2 retrocopies |