RetrogeneDB ID: | retro_pcap_242 | ||
Retrocopylocation | Organism: | Hyrax (Procavia capensis) | |
Coordinates: | scaffold_20739:22009..22407(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYL6B | ||
Ensembl ID: | ENSPCAG00000005927 | ||
Aliases: | None | ||
Description: | myosin, light chain 6B, alkali, smooth muscle and non-muscle [Source:HGNC Symbol;Acc:29823] |
Percent Identity: | 55.07 % |
Parental protein coverage: | 64.56 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 4 |
Parental | ELFDRVGDGKILYGQCG-DVMRA-GQNPTNAEVLKVLGNPKSDEL-KSRRVDFETFLPMLQAVAKNRDQG |
.LFD..GDG.I.Y.Q.G.D.MRA.GQN.T.A.VLKVLGNPKS.E........FE.FLP.L..VAKN.DQG | |
Retrocopy | QLFDPMGDGNIVYSQDG<DLMRALGQNCTSAKVLKVLGNPKSGEM<ECEGAEFEHFLPFLHTVAKNKDQG |
Parental | NYQDYLEGLRVFDKEGNGKVMGAEL-RHVLTTLGERLTEEEVESILAGH-EDINGCINYEAFLKHILS |
.YQD...GL.VFDK.GNG..M..E...HVL.T.G...TEEEVE...AGH..D..G.I..E......L. | |
Retrocopy | TYQDCVKGLQVFDKKGNGPIMDTEI<QHVLVTPGVKTTEEEVEMLVAGH<QDSSGHISCEKLIHMVLN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000000110 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011620 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007592 | 1 retrocopy | |
Homo sapiens | ENSG00000196465 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000003277 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000012658 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005214 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000026948 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017368 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001521 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000005927 | 2 retrocopies |
retro_pcap_223, retro_pcap_242 ,
|
Pongo abelii | ENSPPYG00000004646 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000023043 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000028837 | 2 retrocopies |