RetrogeneDB ID: | retro_pcap_287 | ||
Retrocopylocation | Organism: | Hyrax (Procavia capensis) | |
Coordinates: | scaffold_273154:307..502(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPCAG00000000300 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.73 % |
Parental protein coverage: | 50.39 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | QEADNEVDEEEEEGG-EEEEEEE-EGDGEEEDGDEDEEAEAATGKRAAEDDEDDDVDTKKQKTDEDD |
.....E.D.E....G..EEEEEE...DGEEEDG...E..E.ATGK..A.DDEDDD.D.KKQ...E.D | |
Retrocopy | RKGEQEADNETD*EG>DEEEEEE<KRDGEEEDGHHEETTETATGKWVAGDDEDDDADSKKQMANEAD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000006234 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000000300 | 1 retrocopy |
retro_pcap_287 ,
|
Tursiops truncatus | ENSTTRG00000009156 | 2 retrocopies |