RetrogeneDB ID: | retro_pmar_13 | ||
Retrocopylocation | Organism: | Lamprey (Petromyzon marinus) | |
Coordinates: | GL476660:240429..240630(-) | ||
Located in intron of: | ENSPMAG00000005127 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPMAG00000005110 | ||
Aliases: | None | ||
Description: | Variable lymphocyte receptor B cassette [Source:UniProtKB/TrEMBL;Acc:A5HHB2] |
Percent Identity: | 52.11 % |
Parental protein coverage: | 72.45 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | QTTDCDGKGLSSVPSGIPDNTQNLDLRKNQIDRLPEGVFNPVSNQAHLAANEMTALPARVFNKLTQLTRL |
Q.TDCDGKG.SSV.SGI.D.T..LDLR.N.I..L.EGVFNPV........NE...L.......L...T.L | |
Retrocopy | QITDCDGKGPSSVTSGIADSTHVLDLRSNRIKSLAEGVFNPVGSH---PPNELLTLTWLIKGRL-MITNL |
Parental | D |
D | |
Retrocopy | D |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Petromyzon marinus | ENSPMAG00000005110 | 1 retrocopy |
retro_pmar_13 ,
|