RetrogeneDB ID: | retro_ptro_1520 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 22:41602972..41603401(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C7ORF44 | ||
Ensembl ID: | ENSPTRG00000019125 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.23 % |
Parental protein coverage: | 99.31 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | WQKYAGSRRSMPLGAR-ILFHSVFYAGGFAIVYYLIQKFHSRGLYYKLAVEQLQSHPEAQEALGPPLNIH |
WQKY.GSR...P.G....LF..VF..GG.A.VYY.IQK..SR.LYY.LA.EQ..SHP.AQ.ALGP.LNIH | |
Retrocopy | WQKYPGSRMPVPQGKN>VLFGNVFGTGGLALVYYCIQKTFSRALYYQLALEQVHSHPKAQGALGPLLNIH |
Parental | YLKLIDRENFVDIADAKLKIPVSGSKSEGLLYVHSSRGG-PFQRWHLDEVFLELKDGQQIPVFKLSGENG |
.L.L....NFVDIADAKLKIP.SGSKSEG.L.V.SSR...PFQRWHLDEVFLE.KDGQQIP.FKLSGENG | |
Retrocopy | CLRLT-KHNFVDIADAKLKIPSSGSKSEGHLHVSSSRSA<PFQRWHLDEVFLEPKDGQQIPMFKLSGENG |
Parental | DEVKKE |
.EVKKE | |
Retrocopy | EEVKKE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 21 .04 RPM |
SRP007412_cerebellum | 0 .11 RPM | 22 .05 RPM |
SRP007412_heart | 0 .00 RPM | 21 .98 RPM |
SRP007412_kidney | 0 .00 RPM | 29 .39 RPM |
SRP007412_liver | 0 .07 RPM | 15 .61 RPM |
SRP007412_testis | 0 .00 RPM | 8 .22 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2595 |
Gorilla gorilla | retro_ggor_1624 |
Pongo abelii | retro_pabe_1914 |
Callithrix jacchus | retro_cjac_656 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009377 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000031110 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007826 | 1 retrocopy | |
Homo sapiens | ENSG00000106603 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000034928 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019023 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000018149 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000003316 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017606 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000019125 | 1 retrocopy |
retro_ptro_1520 ,
|