RetrogeneDB ID: | retro_stub_114 | ||
Retrocopylocation | Organism: | Potato (Solanum tuberosum) | |
Coordinates: | 4:40829751..40829985(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | PGSC0003DMG400020480 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 85.9 % |
Parental protein coverage: | 60.94 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | SALGMAISTVVTIAEILKNNGFAVEKKIRTLTVDMRDDPGARPIPKAKIEIVLGKTEKFDELMAAEAEQN |
.ALGMAISTVVTIAEILKNNGFA.EKKIRTLTVDMRD.PGAR.IPKAKIEIV.GK.EKFDE.M.AEAEQN | |
Retrocopy | NALGMAISTVVTIAEILKNNGFAIEKKIRTLTVDMRDEPGARLIPKAKIEIVMGKIEKFDEVMPAEAEQN |
Parental | GDNEEQQN |
GDN.E..N | |
Retrocopy | GDNKE*EN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Solanum tuberosum | PGSC0003DMG400020480 | 1 retrocopy |
retro_stub_114 ,
|