RetrogeneDB ID: | retro_vpac_263 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | GeneScaffold_3436:927714..927909(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MGST2 | ||
| Ensembl ID: | ENSVPAG00000005209 | ||
| Aliases: | None | ||
| Description: | microsomal glutathione S-transferase 2 [Source:HGNC Symbol;Acc:7063] |
Retrocopy-Parental alignment summary:
>retro_vpac_263
CAGAACTGAGTGGAATTTTACCCAATATTCATGACCACCTTCTGGATAGCGGCATGAACTCTGAGCAAGTTTCCCTGCTT
GTCTGGGTCTATCATACCTGTATGCTAGACACCAGTACTTCTGAGGATGTTCAGAAACTGTTCAGCAGAGGTCACTGGCA
TCTAGTTGCACCTGCGGATTTGGCCCTCATTGACT
ORF - retro_vpac_263 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 53.62 % |
| Parental protein coverage: | 52.38 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
Retrocopy - Parental Gene Alignment:
| Parental | QNCVEFYPVFMITLWMA-GLYFNQV-FATCLGLVYVYARYQYFWGYSEDAKKR-ITGFRLSLGVLALLT |
| QN.VEFYP.FM.T.W.A.G....QV.F..CLGL.Y.YAR.QYF.G.SE....R..TG..L.L.....LT | |
| Retrocopy | QN*VEFYPIFMTTFWIA<GMNSEQV<FPACLGLSYLYARHQYF*GCSETVQQR<VTGI*LHLRIWPSLT |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Vicugna pacos was not studied using RNA-Seq expression data.
Vicugna pacos was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_vpac_263 retrocopy.
Vicugna pacos was not studied using FANTOM5 data.
retro_vpac_263 was not experimentally validated.
Retrocopy orthology:
Vicugna pacos does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 2 parental genes, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000019195 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000005209 | 1 retrocopy |
retro_vpac_263 ,
|