Detailed information on CNT0001535 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE (A. thaliana): nothing found

Potential orthologs
: nothing found

Most similar lncRNAs
:
CNT0016555, E-value = 4e-06 (S. tuberosum)

Expression of CNT0001535

Created with Highcharts 4.1.6Chart context menuExpression (RPKM)2.731.2523.5171.7051.11600.3660000.3320000.432leaves (SRR924099)leaves (SRR924144)leaves (SRR926169)seed (SRR639168)shoot apical meristem (SRR824155)shoot apical meristem (SRR824156)shoot apical meristem (SRR824157)shoot apical meristem (SRR824158)shoot apical meristem (SRR824159)shoot apical meristem (SRR824160)shoot apical meristem (SRR824161)shoot apical meristem (SRR824162)shoot apical meristem (SRR824163)whole seed (SRR639162)whole seed (SRR639164)01230.250.50.751.251.51.752.252.52.753.253.53.75

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MVSPKYSSNHATKKKDDAHKQSQVTRRGSPLTNP*

>peptide 2 (39 aa)
KLTIMSFPAFSGLFAILIAAAAAAPDDIPTCDIFIMQTE*

Sequence

>CNT0001535
ACAAACTTACAATAATGAGTTTTCCAGCATTTTCTGGCCTCTTTGCTATCTTAATTGCAGCAGCTGCAGCTGCACCAGATGATATTCCCACCTGCGATAT
ATTTATAATGCAAACAGAATAGCATTAAAAATGCTGCCTCCTCCCAACCACACCCATGGTGTCTCCAAAGTACAGTTCAAATCATGCAACTAAAAAAAAA
GATGATGCACATAAACAAAGCCAAGTCACGAGAAGAGGTAGCCCATTGACAAACCCATAATTTCTTTTCAGGTGAACTTACCAGCAAACCTTCTTTCAAA
GCAAGAAGTTTAGCAGTTTCAATGGCTTCTTCACTTGAAATCTAAAATCACAAACAAACATAAGAGAACTTTTAGAATGCA

lncRNA-RNA interactions

Number of interactions: 5

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA03G40490.1 Cysteine synthase protein coding CNT0001535 1050 381 CDS Cis
GLYMA03G40490.2 Cysteine synthase protein coding CNT0001535 1050 381 CDS Cis
GLYMA05G13621.1 Uncharacterized protein protein coding CNT0001535 440 253 CDS Trans
GLYMA05G13621.2 Uncharacterized protein protein coding CNT0001535 440 253 UTR3 Trans
GLYMA19G43150.1 Cysteine synthase protein coding CNT0001535 684 382 CDS Trans