Detailed information on ENST00000571023

lncRNA-RNA interactions

Number of interactions: 26

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
ENST00000324537 SH3-domain GRB2-like 3 protein coding ENST00000571023 553 270 UTR5 Trans
ENST00000338758 parvin, beta protein coding ENST00000571023 621 267 UTR3 Trans
ENST00000448612 WD repeat domain 27 protein coding ENST00000571023 550 273 CDS Trans
ENST00000588483 tropomyosin 4 protein coding ENST00000571023 575 267 UTR5 Trans
ENST00000620139 melanoregulin protein coding ENST00000571023 553 266 UTR3 Trans
TCONS_00050195 FYVE, RhoGEF and PH domain containing 4 novel protein coding ENST00000571023 609 267 UTR5 Trans
TCONS_00053851 transmembrane protein 263 novel protein coding ENST00000571023 655 268 UTR3 Trans
TCONS_00075813 forkhead box N3 novel protein coding ENST00000571023 641 268 UTR5 Trans
TCONS_00075827 forkhead box N3 novel protein coding ENST00000571023 641 268 UTR3 Trans
TCONS_00119512 zinc finger and BTB domain containing 7C novel protein coding ENST00000571023 605 292 UTR3 Trans
TCONS_00124891 zinc finger protein 540 novel protein coding ENST00000571023 628 268 UTR3 Trans
TCONS_00147100 ATPase family, AAA domain containing 2B novel protein coding ENST00000571023 654 269 UTR3 Trans
TCONS_00147113 ATPase family, AAA domain containing 2B novel protein coding ENST00000571023 654 269 UTR3 Trans
TCONS_00147115 ATPase family, AAA domain containing 2B novel protein coding ENST00000571023 654 269 UTR3 Trans
TCONS_00148698 WD repeat containing planar cell polarit... novel noncoding ENST00000571023 629 290 noncoding Trans
TCONS_00148704 WD repeat containing planar cell polarit... novel protein coding ENST00000571023 629 290 UTR3 Trans
TCONS_00148705 WD repeat containing planar cell polarit... novel protein coding ENST00000571023 629 290 UTR3 Trans
TCONS_00184374 neutral cholesterol ester hydrolase 1 novel protein coding ENST00000571023 661 405 UTR3 Trans
TCONS_00194682 E74-like factor 2 (ets domain transcript... novel protein coding ENST00000571023 613 261 UTR3 Trans
TCONS_00194686 E74-like factor 2 (ets domain transcript... novel protein coding ENST00000571023 613 261 UTR3 Trans
TCONS_00226448 collagen, type XXVIII, alpha 1 novel protein coding ENST00000571023 518 268 UTR5 Trans
TCONS_00226450 collagen, type XXVIII, alpha 1 novel protein coding ENST00000571023 518 268 UTR5 Trans
TCONS_00226462 lincRNA novel noncoding ENST00000571023 518 268 noncoding Trans
TCONS_00226463 lincRNA novel noncoding ENST00000571023 518 268 noncoding Trans
TCONS_00226468 lincRNA novel noncoding ENST00000571023 518 268 noncoding Trans
TCONS_00247058 UDP-Gal:betaGlcNAc beta 1,4- galactosylt... novel protein coding ENST00000571023 619 418 UTR3 Trans

Sequence

>ENST00000571023 (579 nt)
CAAGATGGCGGACCTACTGGGCTCCATCCTGAGCTCCATGGAGAAGCCACCCAGCCTCGGTGACCAGGAGACTCGGCGCAAGGCCCGAGATGCAGAGAAG<br />ACTCGAAAACCAGTTAAAGAACAGTCAGTGGGGCCCGGCCTTGTAGCTCACACCTTTAATACCACCACTTTGGGAGGCCGCGGCGGACGGATCGCTTGAG<br />CCCAGGAGTTCAAGACCAGTCTGGGCAACATGGAGAAACCCCATCTCTACAAAAAATACAAAAATTGGCCGGGCTCACGCCTGTAATCCCAAAACTTTGG<br />GAGGCCAAGGCGGGCAGATCACGAGATCAAGAGATCGAGAGCATCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAATACGAAAATTAGCTGGGCG<br />TGGTGGCGCGTGCCTGTAGTCCCAGCTACTCAGGAGGCTGGGGCAGGAGAATCAGTTGAACCCAGGAGGAGGAGGTTGCAGTGAGCCGAGATTGCGCCAC<br />TGTACTCCAGCCTGGCGACAGAGCGAGACTCCGTCTCATAAATAAATAAATAAATAGATAAATAAATAAATAAATAAAT

Expression



Full and truncated open reading frames discovered in ENST00000571023

In silico ORF/peptide predictions
>peptide 1 (65 aa)
KMADLLGSILSSMEKPPSLGDQETRRKARDAEKTRKPVKEQSVGPGLVAHTFNTTTLGGRGGRIA


RiboTaper predictions from Ribo-Seq data (HEK293 cell line)
Nothing found.

BLAST search results

Best hit to NONCODE v4:
NONHSAT076181 (Evalue: 2.0E-93)

Best hit to Swiss-Prot:
sp|Q8WTZ3|YS049_HUMAN (Evalue: 3.0E-22)