Detailed information on ENST00000616838

lncRNA-RNA interactions

Number of interactions: 16

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
ENST00000399120 holocarboxylase synthetase (biotin-(prop... protein coding ENST00000616838 506 300 UTR5 Trans
ENST00000427746 holocarboxylase synthetase (biotin-(prop... protein coding ENST00000616838 506 300 UTR5 Trans
ENST00000511184 E74-like factor 2 (ets domain transcript... nonsense mediated decay ENST00000616838 546 297 CDS_UTR Trans
ENST00000521027 pleckstrin and Sec7 domain containing 3 protein coding ENST00000616838 523 300 CDS_UTR Trans
ENST00000572705 transient receptor potential cation chan... protein coding ENST00000616838 614 295 UTR3 Trans
ENST00000593250 centrosomal protein 76kDa nonsense mediated decay ENST00000616838 548 300 UTR3 Trans
ENST00000607772 CNKSR family member 3 protein coding ENST00000616838 600 285 UTR3 Trans
TCONS_00026285 cytochrome P450, family 26, subfamily A,... novel protein coding ENST00000616838 510 291 UTR3 Trans
TCONS_00067572 DCN1, defective in cullin neddylation 1,... novel protein coding ENST00000616838 615 299 UTR3 Trans
TCONS_00107851 transient receptor potential cation chan... novel protein coding ENST00000616838 614 295 UTR3 Trans
TCONS_00109011 trans-golgi network vesicle protein 23 h... novel protein coding ENST00000616838 516 290 UTR5 Trans
TCONS_00141404 GLI family zinc finger 2 novel protein coding ENST00000616838 603 290 UTR5 Trans
TCONS_00161482 BTB and CNC homology 1, basic leucine zi... novel protein coding ENST00000616838 601 294 UTR3 Trans
TCONS_00221037 POU class 6 homeobox 2 novel noncoding ENST00000616838 607 300 noncoding Trans
TCONS_00233718 pleckstrin homology domain containing, f... novel protein coding ENST00000616838 604 287 UTR5 Trans
TCONS_00240688 metastasis suppressor 1 novel protein coding ENST00000616838 625 292 CDS_UTR Trans

Sequence

>ENST00000616838 (582 nt)
CACTGCCCTCCAGCCTGGGCAACAAGAGCCAAACTCCCTGTCAAAAAAAAAAAAAAAGAAAGCAGTTGTTGGACAGTGGGTTGGCCATTCTTAGAACGAC<br />TTGGAGGCTTATTTTATTCTGGGTTGTTCTAAAAAGGACAGGACATTTACTGGTCATATGTGATAAAATAAATAGTCTATTAAATGAAATCTAATTATTG<br />TTAATCATTGATGCCCTATGGATAATGTCAAAAGTCATCAGACTGGGGATGGTGGCTCATGCCTGTAACCCCAGCACTTTGGTAGGATGAGGCCGGCGGA<br />TCACTTGAGGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACTTCTTACCTACTAAAAATACAAAAATTAGCCAGGTGTGGTGGTGTGCGCCTA<br />TAGTCCTGGCTACTTGAGAGGCTAAAGCAGAAGAATCGCTCGAACCTGGGAGATGGAGGTTGCAGTGAACCGAGATCACACCACTGCACTCCAGCCTGGG<br />TGACAGAGTGAGACTCTGTCTCAAAAAAAGAAAAAACAAAGCCATCAGTCTTGTAATTAAACGTGATTTGTCTTTATCCACA

Expression



Full and truncated open reading frames discovered in ENST00000616838

In silico ORF/peptide predictions
>peptide 1 (63 aa)
LPSSLGNKSQTPCQKKKKRKQLLDSGLAILRTTWRLILFWVVLKRTGHLLVICDKINSLLNEI


RiboTaper predictions from Ribo-Seq data (HEK293 cell line)
Nothing found.

BLAST search results

Best hit to NONCODE v4:
NONHSAT141705 (Evalue: 2.0E-66)

Best hit to Swiss-Prot:
sp|Q8N2A0|CX062_HUMAN (Evalue: 7.0E-33)