RetrogeneDB ID: | retro_acar_88 | ||
Retrocopy location | Organism: | Anole lizard (Anolis carolinensis) | |
| Coordinates: | 2:41302572..41302917(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPL22 | ||
| Ensembl ID: | ENSACAG00000003875 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 93.04 % |
| Parental protein coverage: | 56.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TSLFILSFRVLTSFGTPLFCNIHTSASLGNLGRWEKKNRVVYPPQQPGEPRRPAEIYHCRRDIKYSKDKM |
| .S..I...RVLTSFGTPLFCNIHTSASLGNLGRWEKKNRVVYPPQQPGEPRRPAEIYHCRRDIKYSKDKM | |
| Retrocopy | SSGWIRASRVLTSFGTPLFCNIHTSASLGNLGRWEKKNRVVYPPQQPGEPRRPAEIYHCRRDIKYSKDKM |
| Parental | WYLAKLIRGMTIDEALAQLEFNDKKGAKVIKEVLLEAQEMAVRKC |
| WYLAKLIRGMTIDEALAQLEFNDKKGAKV.KEVLLEAQEMAVR.C | |
| Retrocopy | WYLAKLIRGMTIDEALAQLEFNDKKGAKVMKEVLLEAQEMAVRTC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP009831_adrenal | 3 .61 RPM | 24 .81 RPM |
| SRP009831_brain | 2 .51 RPM | 9 .18 RPM |
| SRP009831_dewlap | 1 .94 RPM | 6 .29 RPM |
| SRP009831_embryo | 7 .23 RPM | 29 .19 RPM |
| SRP009831_heart | 4 .36 RPM | 11 .83 RPM |
| SRP009831_liver | 3 .89 RPM | 22 .66 RPM |
| SRP009831_lung | 1 .21 RPM | 13 .35 RPM |
| SRP009831_ovary | 1 .74 RPM | 8 .42 RPM |
| SRP009831_skeletal_muscle | 2 .26 RPM | 8 .96 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000003875 | 1 retrocopy |
retro_acar_88 ,
|
| Bos taurus | ENSBTAG00000019457 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017605 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007325 | 2 retrocopies | |
| Homo sapiens | ENSG00000082515 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010232 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021229 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020514 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016692 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016777 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015979 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017453 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000001170 | 1 retrocopy |