RetrogeneDB ID: | retro_amel_710 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192583.1:896865..897272(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSAMEG00000001119 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL10A | ||
| Ensembl ID: | ENSAMEG00000000670 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L10a [Source:HGNC Symbol;Acc:10299] |
| Percent Identity: | 83.94 % |
| Parental protein coverage: | 62.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | IPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEV |
| IPHMDIE.LKKLNKN.KL.KKLAKKYDAFLASESLIKQIP.ILGPGL.KA.KF.SLLTHN.NMVAKVDEV | |
| Retrocopy | IPHMDIEVLKKLNKNRKLIKKLAKKYDAFLASESLIKQIPCILGPGLSKASKFSSLLTHNGNMVAKVDEV |
| Parental | -KSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY |
| ..STIKFQMKKVLCLA...GH.KMTDDEL.YNIHLAVN.L.SL.KKNWQN..ALY.KSTMGKPQ.LY | |
| Retrocopy | <ESTIKFQMKKVLCLAGTIGHMKMTDDELMYNIHLAVNLLASLFKKNWQNIQALYVKSTMGKPQGLY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000670 | 13 retrocopies | |
| Echinops telfairi | ENSETEG00000013325 | 2 retrocopies | |
| Felis catus | ENSFCAG00000012904 | 7 retrocopies | |
| Homo sapiens | ENSG00000198755 | 13 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028140 | 10 retrocopies | |
| Macropus eugenii | ENSMEUG00000005760 | 6 retrocopies | |
| Macaca mulatta | ENSMMUG00000015907 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000013766 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008650 | 13 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000014574 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004065 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000000505 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000002047 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009431 | 6 retrocopies |