RetrogeneDB ID: | retro_btau_593 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 15:34088430..34088797(-) | ||
| Located in intron of: | ENSBTAG00000013989 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ZFAND6 | ||
| Ensembl ID: | ENSBTAG00000012321 | ||
| Aliases: | ZFAND6, ZA20D3 | ||
| Description: | AN1-type zinc finger protein 6 [Source:UniProtKB/Swiss-Prot;Acc:Q3SZY7] |
| Percent Identity: | 76.42 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQ-NSSNGRISPPAPSVTSLSESLPVQCTDG |
| .A.ETNHSQVP.LCS.GC.FYGNP.TNGMCSV..KEHLQ.....S.GRISPP..SV.SLSESLP.Q.TDG | |
| Retrocopy | VA*ETNHSQVPVLCSAGCRFYGNPSTNGMCSVRNKEHLQIVVQNSDGRISPPVLSVSSLSESLPAQSTDG |
| Parental | SVPEAQSALDSTASSVQPSPVSNQSLLSESVASS-QVDSTSVDKAIPETEDLQ |
| SVPEAQSALD.T.SS..PSPVS.QSLLSESV.SS.QVDSTS.DKAI.ET.DLQ | |
| Retrocopy | SVPEAQSALDTTSSSM*PSPVSHQSLLSESVVSS>QVDSTSMDKAILETDDLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 4 .33 RPM |
| ERP005899_muscle | 0 .00 RPM | 20 .38 RPM |
| SRP017611_brain | 0 .00 RPM | 5 .02 RPM |
| SRP017611_kidney | 0 .00 RPM | 25 .37 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .65 RPM |
| SRP030211_testis | 0 .03 RPM | 66 .24 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012321 | 1 retrocopy |
retro_btau_593 ,
|
| Choloepus hoffmanni | ENSCHOG00000009491 | 2 retrocopies | |
| Felis catus | ENSFCAG00000012931 | 2 retrocopies | |
| Homo sapiens | ENSG00000086666 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015621 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000006722 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019428 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008870 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007361 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000013506 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000001779 | 2 retrocopies |