RetrogeneDB ID: | retro_cfam_1279 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 28:15703821..15704007(-) | ||
| Located in intron of: | ENSCAFG00000010380 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LYRM7 | ||
| Ensembl ID: | ENSCAFG00000000736 | ||
| Aliases: | None | ||
| Description: | LYR motif containing 7 [Source:HGNC Symbol;Acc:28072] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 62.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QVFKNDTRALEAARIKINEEFKSNKSETSPKKIEELIKIGSDVELLLRTSVIQGIHTDHNTL |
| QVFKNDTRALEAARIKINEEFKSNKSETSPKKIEELIKIGSDVELLLRTSVIQGIHTDHNTL | |
| Retrocopy | QVFKNDTRALEAARIKINEEFKSNKSETSPKKIEELIKIGSDVELLLRTSVIQGIHTDHNTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .67 RPM | 3 .61 RPM |
| SRP017611_brain | 0 .32 RPM | 3 .18 RPM |
| SRP017611_kidney | 2 .58 RPM | 11 .42 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .58 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017776 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000000736 | 1 retrocopy |
retro_cfam_1279 ,
|
| Choloepus hoffmanni | ENSCHOG00000006766 | 6 retrocopies | |
| Echinops telfairi | ENSETEG00000010130 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000166 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015568 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000045961 | 1 retrocopy |