RetrogeneDB ID: | retro_cfam_1304 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 29:12702931..12703280(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CHMP4B | ||
| Ensembl ID: | ENSCAFG00000007478 | ||
| Aliases: | None | ||
| Description: | charged multivesicular body protein 4B [Source:HGNC Symbol;Acc:16171] |
| Percent Identity: | 72.88 % |
| Parental protein coverage: | 52.23 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | STIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQ-ELAEEISTAISKPVGF |
| .T.EFQ.EALENANT.TEVL.NMGY..KAMK.A.DNMD.D...ELMQ..ADQQ...AEEIST.IS.PVGF | |
| Retrocopy | ATMEFQ*EALENANTDTEVL*NMGYSSKAMKVAQDNMDTDQDEELMQAMADQQ>HEAEEISTGISNPVGF |
| Parental | GEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSITLPSKP |
| GEEFD.DEL.AE..EL..EELD.NLL.ISGPE.VPLPNVP..TLPS.P | |
| Retrocopy | GEEFDQDELLAE-*ELQ*EELDRNLLQISGPEPVPLPNVPFLTLPSNP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 121 .17 RPM |
| SRP017611_brain | 0 .00 RPM | 122 .58 RPM |
| SRP017611_kidney | 0 .00 RPM | 80 .17 RPM |
| SRP017611_liver | 0 .00 RPM | 20 .59 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009038 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000007478 | 1 retrocopy |
retro_cfam_1304 ,
|
| Choloepus hoffmanni | ENSCHOG00000007288 | 1 retrocopy | |
| Equus caballus | ENSECAG00000008311 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025893 | 1 retrocopy | |
| Homo sapiens | ENSG00000101421 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007775 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008084 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000017821 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010020 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010931 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013408 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000010293 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000046585 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013212 | 1 retrocopy |