RetrogeneDB ID: | retro_cfam_1636 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 38:16052005..16052440(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C18orf21 | ||
| Ensembl ID: | ENSCAFG00000029548 | ||
| Aliases: | None | ||
| Description: | chromosome 18 open reading frame 21 [Source:HGNC Symbol;Acc:28802] |
| Percent Identity: | 97.24 % |
| Parental protein coverage: | 67.13 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LLNREARNCTLSFKEAKILKKYRDSKGVLLTTCKTCNRTVKHHGKSRSFLSALKSSPTTPTSKLSLKTPE |
| .LNREARNCTLSFKEAKILKKY.DSKGVLLTTCKTCNRTVKHHGKSRSFLSALKSSPTTPTSKLSLKTPE | |
| Retrocopy | VLNREARNCTLSFKEAKILKKYKDSKGVLLTTCKTCNRTVKHHGKSRSFLSALKSSPTTPTSKLSLKTPE |
| Parental | RRTPSSAKLSHMYGSKGKSPASIFRTPTSGQSTPTCASKNMSKRKKHLSQLKMLLSQSESQKNSKVDFRN |
| R.TPSSAKLSHMYGSKGKSPASIFRTPTSGQSTPTCASKNMSKRKKHLSQLKMLLSQSE.QKNSKVDFRN | |
| Retrocopy | RKTPSSAKLSHMYGSKGKSPASIFRTPTSGQSTPTCASKNMSKRKKHLSQLKMLLSQSETQKNSKVDFRN |
| Parental | FLLSL |
| FLLSL | |
| Retrocopy | FLLSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .04 RPM | 15 .75 RPM |
| SRP017611_brain | 0 .00 RPM | 15 .16 RPM |
| SRP017611_kidney | 0 .07 RPM | 19 .22 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .61 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000029548 | 1 retrocopy |
retro_cfam_1636 ,
|
| Callithrix jacchus | ENSCJAG00000021041 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000025449 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000626 | 1 retrocopy | |
| Homo sapiens | ENSG00000141428 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026334 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018782 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000025605 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024273 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006237 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000028046 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000011163 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000009110 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009973 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009174 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000016670 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010817 | 2 retrocopies |