RetrogeneDB ID: | retro_cjac_1599 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 17:48802240..48802604(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000003642 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PDCL3 | ||
| Ensembl ID: | ENSCJAG00000010160 | ||
| Aliases: | None | ||
| Description: | phosducin-like 3 [Source:HGNC Symbol;Acc:28860] |
| Percent Identity: | 80.65 % |
| Parental protein coverage: | 51.05 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MQDPNTDTEWNDILRKKGILPPKESLKEL-EEEAEEEQHMVQQSVVTTYEDMTLEELKDHEDEFNEEDER |
| .QDP..DTEWN.IL.KKGILPPK.S.KEL.E.EAEEEQ...QQSV.TTYED.TLEELKDHEDEFNEE.E. | |
| Retrocopy | IQDPKADTEWNNILCKKGILPPKKSQKEL<EKEAEEEQCILQQSVMTTYEDRTLEELKDHEDEFNEEEEC |
| Parental | AIEMYRRQRLAEWKATKLKNKFGEVLEIS-GKDYVQEVTKAGEGLWVILHLYKQ |
| AIEMYR.Q.LAEWKA.KLKNKFGEVLEIS..KDY.QEVTKA.EGLWVILHLYK. | |
| Retrocopy | AIEMYRWQGLAEWKAMKLKNKFGEVLEIS<RKDYFQEVTKACEGLWVILHLYKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .07 RPM | 10 .38 RPM |
| SRP051959_heart | 0 .00 RPM | 14 .07 RPM |
| SRP051959_kidney | 0 .02 RPM | 14 .22 RPM |
| SRP051959_liver | 0 .00 RPM | 4 .14 RPM |
| SRP051959_lung | 0 .02 RPM | 8 .90 RPM |
| SRP051959_lymph_node | 0 .16 RPM | 6 .89 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 8 .95 RPM |
| SRP051959_spleen | 0 .00 RPM | 8 .07 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002226 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010160 | 3 retrocopies |
retro_cjac_1486, retro_cjac_1599 , retro_cjac_2055,
|
| Dipodomys ordii | ENSDORG00000012397 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000000224 | 1 retrocopy | |
| Homo sapiens | ENSG00000115539 | 7 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016446 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001489 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026078 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014393 | 8 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000001469 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000015138 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000011600 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006242 | 1 retrocopy |