RetrogeneDB ID: | retro_cjac_2282 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 3:138360078..138360454(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | METTL5 | ||
Ensembl ID: | ENSCJAG00000006777 | ||
Aliases: | None | ||
Description: | methyltransferase like 5 [Source:HGNC Symbol;Acc:25006] |
Percent Identity: | 64.06 % |
Parental protein coverage: | 51.64 % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 2 |
Parental | RLQQVDEFEKP-KLLLEQYPTRPHIAACMLYTIHNTYDDIENKVIADLGCGCGVLSIGSAMLGAGL-CVG |
.LQ.VD.F..P..LLLE.YPTR.HI.AC.LYTI..T.DDIE.KV..DL..G.G.LSI..AM.GAGL..V. | |
Retrocopy | QLQ*VDGFK*P<SLLLE*YPTRMHI*ACVLYTILYTWDDIEIKVVTDLEPGNGALSIPAAMGGAGL<VVV |
Parental | FDIDEDALEIFNRNVEEFELTNIDMIQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGT |
..IDEDAL.IFNRNVEEFE..N..M..CD.C....RMSKS.DTVIMNP.FGT..NKG. | |
Retrocopy | LNIDEDALKIFNRNVEEFESGNVVMFYCDMCS*FSRMSKSLDTVIMNPHFGTTYNKGS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 2 .46 RPM |
SRP051959_heart | 0 .00 RPM | 3 .42 RPM |
SRP051959_kidney | 0 .00 RPM | 4 .50 RPM |
SRP051959_liver | 0 .00 RPM | 3 .90 RPM |
SRP051959_lung | 0 .02 RPM | 2 .80 RPM |
SRP051959_lymph_node | 0 .00 RPM | 3 .58 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 4 .13 RPM |
SRP051959_spleen | 0 .00 RPM | 2 .94 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2930 |
Pan troglodytes | retro_ptro_2062 |
Gorilla gorilla | retro_ggor_2032 |
Pongo abelii | retro_pabe_2523 |
Macaca mulatta | retro_mmul_1953 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000012438 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000006777 | 2 retrocopies |
retro_cjac_2282 , retro_cjac_729,
|
Dasypus novemcinctus | ENSDNOG00000013460 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000022484 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000018044 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000002154 | 2 retrocopies |