RetrogeneDB ID: | retro_cjac_3333 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 9:102260101..102260347(-) | ||
Located in intron of: | ENSCJAG00000012100 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000004610 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.71 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV |
MAFTLYSLL.AALL.V.AIA.LH.ERFLKNIGW.TDQGIG.FGEEPGIKS.LMN.I.SV.TVMR.PLI.V | |
Retrocopy | MAFTLYSLLEAALLFVSAIAMLHKERFLKNIGWRTDQGIGIFGEEPGIKSRLMNRI*SVTTVMRMPLIMV |
Parental | NSIAIVLLLLFG |
NSI..VLLLLFG | |
Retrocopy | NSIVVVLLLLFG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 0 .67 RPM |
SRP051959_heart | 0 .02 RPM | 0 .70 RPM |
SRP051959_kidney | 0 .09 RPM | 1 .69 RPM |
SRP051959_liver | 0 .00 RPM | 1 .19 RPM |
SRP051959_lung | 0 .23 RPM | 0 .70 RPM |
SRP051959_lymph_node | 0 .00 RPM | 0 .66 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 1 .16 RPM |
SRP051959_spleen | 0 .00 RPM | 0 .97 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy |
retro_cjac_3333 ,
|
Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
Homo sapiens | ENSG00000134049 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |