RetrogeneDB ID: | retro_ptro_791 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 12:112472415..112472661(-) | ||
| Located in intron of: | ENSPTRG00000005467 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPTRG00000010002 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.59 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV |
| MAFTLYSLLQAALLCV.AIA.LH.ERFLKNIGW..DQ.IGGFGEEP.IKSQLMN.I.SV.TVMR.PLIIV | |
| Retrocopy | MAFTLYSLLQAALLCVSAIAMLHKERFLKNIGWRIDQRIGGFGEEPEIKSQLMNCIQSVTTVMRMPLIIV |
| Parental | NSIAIVLLLLFG |
| NSIAIVLLLLFG | |
| Retrocopy | NSIAIVLLLLFG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 8 .35 RPM |
| SRP007412_cerebellum | 0 .07 RPM | 20 .18 RPM |
| SRP007412_heart | 0 .09 RPM | 16 .09 RPM |
| SRP007412_kidney | 0 .13 RPM | 45 .63 RPM |
| SRP007412_liver | 0 .03 RPM | 41 .25 RPM |
| SRP007412_testis | 0 .00 RPM | 16 .86 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1156 |
| Gorilla gorilla | retro_ggor_903 |
| Pongo abelii | retro_pabe_962 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
| Homo sapiens | ENSG00000134049 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy |
retro_ptro_791 ,
|
| Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |