RetrogeneDB ID: | retro_ptro_791 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 12:112472415..112472661(-) | ||
Located in intron of: | ENSPTRG00000005467 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPTRG00000010002 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 86.59 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV |
MAFTLYSLLQAALLCV.AIA.LH.ERFLKNIGW..DQ.IGGFGEEP.IKSQLMN.I.SV.TVMR.PLIIV | |
Retrocopy | MAFTLYSLLQAALLCVSAIAMLHKERFLKNIGWRIDQRIGGFGEEPEIKSQLMNCIQSVTTVMRMPLIIV |
Parental | NSIAIVLLLLFG |
NSIAIVLLLLFG | |
Retrocopy | NSIAIVLLLLFG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 8 .35 RPM |
SRP007412_cerebellum | 0 .07 RPM | 20 .18 RPM |
SRP007412_heart | 0 .09 RPM | 16 .09 RPM |
SRP007412_kidney | 0 .13 RPM | 45 .63 RPM |
SRP007412_liver | 0 .03 RPM | 41 .25 RPM |
SRP007412_testis | 0 .00 RPM | 16 .86 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1156 |
Gorilla gorilla | retro_ggor_903 |
Pongo abelii | retro_pabe_962 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
Homo sapiens | ENSG00000134049 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy |
retro_ptro_791 ,
|
Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |