RetrogeneDB ID: | retro_cjac_3543 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | ACFV01183761.1:3244..3529(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LTBP4 | ||
Ensembl ID: | ENSCJAG00000037941 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 60.42 % |
Parental protein coverage: | 53.33 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | ESCCVVQTGVQWHDLGSLQPPPPGFKRFSCLSLPSSWDYRRTPPCPANFLVLLPTGFCHVGKAGLKFLAS |
.SC.V.Q.GVQWH.L.SLQP.PP.FKRFSCLSL.SS.DYR..PPCPAN.......GF.HV..AGLK.L.S | |
Retrocopy | QSCSVTQVGVQWHNLSSLQPLPPSFKRFSCLSLLSSRDYRHLPPCPANY-I*VEMGFQHVVQAGLKLLTS |
Parental | SDPPIFASQSAGITGVSHSAENRLNI |
.D.P...SQ.AG.TGVS..A...L.. | |
Retrocopy | GDSPASTSQTAGMTGVSPCAQPQLHL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 13 .16 RPM |
SRP051959_heart | 0 .00 RPM | 81 .88 RPM |
SRP051959_kidney | 0 .00 RPM | 6 .41 RPM |
SRP051959_liver | 0 .00 RPM | 1 .04 RPM |
SRP051959_lung | 0 .00 RPM | 17 .91 RPM |
SRP051959_lymph_node | 0 .00 RPM | 4 .06 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 8 .63 RPM |
SRP051959_spleen | 0 .00 RPM | 13 .36 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000017963 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000037941 | 35 retrocopies |
retro_cjac_3343, retro_cjac_3355, retro_cjac_3369, retro_cjac_3372, retro_cjac_3389, retro_cjac_3391, retro_cjac_3423, retro_cjac_3425, retro_cjac_3430, retro_cjac_3445, retro_cjac_3456, retro_cjac_3474, retro_cjac_3476, retro_cjac_3477, retro_cjac_3487, retro_cjac_3491, retro_cjac_3543 , retro_cjac_3545, retro_cjac_3547, retro_cjac_3549, retro_cjac_3566, retro_cjac_3583, retro_cjac_3598, retro_cjac_3609, retro_cjac_3616, retro_cjac_3622, retro_cjac_3633, retro_cjac_3641, retro_cjac_3656, retro_cjac_3672, retro_cjac_3674, retro_cjac_3677, retro_cjac_3682, retro_cjac_3733, retro_cjac_3736,
|