RetrogeneDB ID: | retro_cjac_496 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 1:201496218..201496543(+) | ||
Located in intron of: | ENSCJAG00000004636 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | JTB | ||
Ensembl ID: | ENSCJAG00000009973 | ||
Aliases: | None | ||
Description: | jumping translocation breakpoint [Source:HGNC Symbol;Acc:6201] |
Percent Identity: | 52.21 % |
Parental protein coverage: | 74.83 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | EKLSAVSTSNLPCWLVGEFVVSEECSPCSSFQAKTTPECGPTGYVEKITCSSSK-RNEFKS-CRSALMEQ |
...SA.S......W........E...P.S.F.AKT.PECG.T..VEK.T..SS..RNEFKS....AL... | |
Retrocopy | DRVSAASVP*EEQWS*APQICVERGTPHSHF*AKTIPECGFTESVEK-TTCSSP>RNEFKS>VCPALTQP |
Parental | RLFWKFEGAVVCVALIFACLVIIRQRQLDR-KALEKVRKQIES |
RLFWKFEGAV...ALIF.CLVI..Q.QL...KALE.V..Q.ES | |
Retrocopy | RLFWKFEGAV-GLALIFDCLVISCQLQLGK<KALENVWRQVES |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .11 RPM | 9 .61 RPM |
SRP051959_heart | 0 .19 RPM | 7 .40 RPM |
SRP051959_kidney | 0 .24 RPM | 12 .69 RPM |
SRP051959_liver | 0 .09 RPM | 17 .72 RPM |
SRP051959_lung | 0 .23 RPM | 7 .94 RPM |
SRP051959_lymph_node | 0 .18 RPM | 9 .31 RPM |
SRP051959_skeletal_muscle | 0 .17 RPM | 15 .09 RPM |
SRP051959_spleen | 0 .21 RPM | 11 .01 RPM |
Species | RetrogeneDB ID |
---|---|
Pongo abelii | retro_pabe_1886 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000002520 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009973 | 1 retrocopy |
retro_cjac_496 ,
|
Dasypus novemcinctus | ENSDNOG00000000740 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008256 | 1 retrocopy | |
Felis catus | ENSFCAG00000012590 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000013299 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000011788 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000003210 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000791 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000006559 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000012646 | 1 retrocopy |