RetrogeneDB ID: | retro_cjac_632 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 1:166240569..166240936(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSMB1 | ||
Ensembl ID: | ENSCJAG00000020644 | ||
Aliases: | None | ||
Description: | proteasome (prosome, macropain) subunit, beta type, 1 [Source:HGNC Symbol;Acc:9537] |
Percent Identity: | 67.97 % |
Parental protein coverage: | 63.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 4 |
Parental | LGMEPHRAAGPLQLRFSP-YAFNGGTVLAIAGEDFSIVASDTRLSEGF-SIHTRDSPKCYK-LTDKTVIG |
L..EP....GPL.L..SP.YAF...T.LA.AGEDFSIVASDT.LS.GF.SI....S.KCYK..TDKTVIG | |
Retrocopy | LTVEPPTPPGPLRLHVSP>YAFYRDTGLATAGEDFSIVASDTVLSQGF<SIYIWNSSKCYK<ITDKTVIG |
Parental | CSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILY-SRRFFPYYVYNII |
CS.F.GDCL.LTK.IEA.LKMYKH.NNKAMTTGAI...L.TILY.SR.F.PY..Y.II | |
Retrocopy | CSSFPGDCLPLTKTIEAKLKMYKHPNNKAMTTGAI-PVLPTILY<SRHFCPYDGYSII |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 29 .93 RPM |
SRP051959_heart | 0 .02 RPM | 25 .06 RPM |
SRP051959_kidney | 0 .00 RPM | 30 .75 RPM |
SRP051959_liver | 0 .00 RPM | 35 .72 RPM |
SRP051959_lung | 0 .00 RPM | 23 .78 RPM |
SRP051959_lymph_node | 0 .00 RPM | 26 .85 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 24 .24 RPM |
SRP051959_spleen | 0 .00 RPM | 29 .81 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017047 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000004116 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000020644 | 1 retrocopy |
retro_cjac_632 ,
|
Dasypus novemcinctus | ENSDNOG00000019502 | 1 retrocopy | |
Felis catus | ENSFCAG00000031269 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022128 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000007469 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019919 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000007150 | 1 retrocopy | |
Mus musculus | ENSMUSG00000014769 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007973 | 2 retrocopies | |
Procavia capensis | ENSPCAG00000000344 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017191 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000006517 | 1 retrocopy |