RetrogeneDB ID: | retro_cjac_656 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 1:202785070..202785494(-) | ||
Located in intron of: | ENSCJAG00000009771 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COA1 | ||
Ensembl ID: | ENSCJAG00000007826 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:21868] |
Percent Identity: | 58.9 % |
Parental protein coverage: | 97.93 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | QTHPRSRMSM-SPAKMIIYGSVLCTGGFSLAYFIIQKTY-SRSLYYQLALEQLQIHPGAQEALGPP-VSV |
Q..P.SRM......KM....S...T.G..L.Y...QKT..SR...Y.LALE....HP.A..ALGPP.... | |
Retrocopy | QKYPGSRMPV<ASRKMVLFSSIFGTWGLALVYYLTQKTF<SRASFY*LALEHVRSHPKARGALGPP<FNI |
Parental | HHLKLTGKDNFVDIADAKLKI-PVSGSKSEGHLHVHSTRSGPFQRWHLDEVFLELKDGQQIPVFNLSGEN |
..LKL..K..FVDIADAKLKI.P.SGSKSEGHL.V.S.RSGP.QR..LD..FLELKDGQQIP.F.LSGEN | |
Retrocopy | YILKLSDKQDFVDIADAKLKI>PISGSKSEGHLQVSSSRSGPIQRCCLDDIFLELKDGQQIPMFKLSGEN |
Parental | GDEVKK |
G.EV.K | |
Retrocopy | GEEVRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .42 RPM | 2 .46 RPM |
SRP051959_heart | 0 .33 RPM | 3 .51 RPM |
SRP051959_kidney | 0 .49 RPM | 3 .37 RPM |
SRP051959_liver | 0 .39 RPM | 2 .62 RPM |
SRP051959_lung | 0 .24 RPM | 6 .78 RPM |
SRP051959_lymph_node | 0 .18 RPM | 11 .96 RPM |
SRP051959_skeletal_muscle | 0 .24 RPM | 2 .66 RPM |
SRP051959_spleen | 0 .38 RPM | 7 .69 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2595 |
Pan troglodytes | retro_ptro_1520 |
Gorilla gorilla | retro_ggor_1624 |
Pongo abelii | retro_pabe_1914 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009377 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000031110 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007826 | 1 retrocopy |
retro_cjac_656 ,
|
Homo sapiens | ENSG00000106603 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000034928 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019023 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000018149 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000003316 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017606 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000019125 | 1 retrocopy |