RetrogeneDB ID: | retro_mmul_653 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 10:86835138..86835569(-) | ||
| Located in intron of: | ENSMMUG00000002229 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2450 | ||
| Ensembl ID: | ENSMMUG00000019023 | ||
| Aliases: | COA1, C3H7orf44 | ||
| Description: | cytochrome oxidase assembly 1 [Source:RefSeq peptide;Acc:NP_001252565] |
| Percent Identity: | 70.07 % |
| Parental protein coverage: | 99.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | WQKYPGSRQSIPLGIK-VLFSGVFGAGGFALVYYLIQKFH-SRSLYYKLAVEQLQSHPEAQEALGPPLNI |
| WQKYPGSR...P.G...VLF..VF..GG.ALVYYLIQK...SR...Y.LA.EQ..SHP.AQ.ALGP.LNI | |
| Retrocopy | WQKYPGSRMPVPQGKN>VLFGNVFSTGGLALVYYLIQKTF<SRASCYQLALEQVHSHPKAQGALGPLLNI |
| Parental | HYLKLTDRENFVDIADAKLKIPVSGSKSEGLLYVHSSRGGP-FQRWHLDEVFLELKDGQQIPVFKLSGEN |
| ..LKLT...NFVDIADAKLKIP.SGSKSE..L...SSR..P.FQRWHLDEVFLE.KD.QQIP.FKLSGEN | |
| Retrocopy | QCLKLTNKHNFVDIADAKLKIPSSGSKSESRLHISSSRSAP<FQRWHLDEVFLEPKDCQQIPMFKLSGEN |
| Parental | GDEVKKE |
| G.EVKK. | |
| Retrocopy | GEEVKKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 10 .42 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .24 RPM | 12 .30 RPM |
| SRP007412_cerebellum | 0 .52 RPM | 10 .27 RPM |
| SRP007412_heart | 0 .12 RPM | 10 .30 RPM |
| SRP007412_kidney | 0 .23 RPM | 10 .68 RPM |
| SRP007412_liver | 0 .16 RPM | 8 .71 RPM |
| SRP007412_testis | 0 .08 RPM | 5 .73 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009377 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000031110 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007826 | 1 retrocopy | |
| Homo sapiens | ENSG00000106603 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000034928 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019023 | 1 retrocopy |
retro_mmul_653 ,
|
| Mustela putorius furo | ENSMPUG00000018149 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003316 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017606 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000019125 | 1 retrocopy |