RetrogeneDB ID: | retro_cjac_906 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 11:42758904..42759144(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000004999 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.48 % |
Parental protein coverage: | 70.43 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY |
MAKH.PDLIFC.KQAGVAI.RLCEKCDGKCVICDSY...CTLV.ICDECNYGS....CV.CGGPG.SDAY | |
Retrocopy | MAKH-PDLIFCHKQAGVAIRRLCEKCDGKCVICDSYMCSCTLVHICDECNYGSC*EHCVTCGGPGLSDAY |
Parental | YCKECTIQEKD |
.CKECT.QEKD | |
Retrocopy | FCKECTVQEKD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 2 .44 RPM |
SRP051959_heart | 0 .02 RPM | 2 .60 RPM |
SRP051959_kidney | 0 .00 RPM | 3 .33 RPM |
SRP051959_liver | 0 .00 RPM | 3 .21 RPM |
SRP051959_lung | 0 .00 RPM | 2 .88 RPM |
SRP051959_lymph_node | 0 .00 RPM | 3 .42 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 3 .58 RPM |
SRP051959_spleen | 0 .00 RPM | 2 .94 RPM |