RetrogeneDB ID: | retro_cpor_1102 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_46:1164483..1164660(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLE4 | ||
| Ensembl ID: | ENSCPOG00000027003 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 50.79 % |
| Parental protein coverage: | 56.25 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | KADPDVTLAGQEAIFVLARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLE |
| K..PDV...G...I........L.VE.IAKDA.C...QG..KTLQ..DLD.AIE..DE..FLE | |
| Retrocopy | KLQPDVQGTG---IHICSDTS*LCVEIIAKDACCSVHQGRKKTLQGIDLDDAIE-LDEVTFLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .83 RPM |
| SRP017611_kidney | 0 .00 RPM | 16 .02 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .75 RPM |
| SRP040447_lung | 0 .00 RPM | 7 .82 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 2 .67 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017073 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017156 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000027003 | 1 retrocopy |
retro_cpor_1102 ,
|
| Felis catus | ENSFCAG00000005983 | 1 retrocopy | |
| Homo sapiens | ENSG00000115350 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004491 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008356 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001111 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012258 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012105 | 1 retrocopy |