RetrogeneDB ID: | retro_cpor_1102 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_46:1164483..1164660(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | POLE4 | ||
Ensembl ID: | ENSCPOG00000027003 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 50.79 % |
Parental protein coverage: | 56.25 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KADPDVTLAGQEAIFVLARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLE |
K..PDV...G...I........L.VE.IAKDA.C...QG..KTLQ..DLD.AIE..DE..FLE | |
Retrocopy | KLQPDVQGTG---IHICSDTS*LCVEIIAKDACCSVHQGRKKTLQGIDLDDAIE-LDEVTFLE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 4 .83 RPM |
SRP017611_kidney | 0 .00 RPM | 16 .02 RPM |
SRP017611_liver | 0 .00 RPM | 5 .75 RPM |
SRP040447_lung | 0 .00 RPM | 7 .82 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 2 .67 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017073 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000017156 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000027003 | 1 retrocopy |
retro_cpor_1102 ,
|
Felis catus | ENSFCAG00000005983 | 1 retrocopy | |
Homo sapiens | ENSG00000115350 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004491 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000008356 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001111 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012258 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012105 | 1 retrocopy |