RetrogeneDB ID: | retro_cpor_749 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_26:24536105..24536472(+) | ||
| Located in intron of: | ENSCPOG00000005675 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HN1L | ||
| Ensembl ID: | ENSCPOG00000005352 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.12 % |
| Parental protein coverage: | 65.26 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 3 |
| Parental | VPSNRPN-RMASNIFGPT-EEPQNIPKRTNPPGGKGSGIFDESTPVQTRQRLNPPGGKASDIFGSPVTAA |
| V.SNRP..R.ASNIF.....EPQNIP.RT.P...KGS..F.E..PV.T...LNP.G.K.SDIF.S.VTA. | |
| Retrocopy | VLSNRPK<RLASNIFKNS>KEPQNIPQRTSPSVEKGSDTFNELAPVKTH--LNPAGVKNSDIFDSSVTAT |
| Parental | SPLAHPNKPKDHILLCEGEDPKSDLKAATSTS-PQDELGTKGSSREVDHTKELEPMP |
| .PL.HPNKPK.....CE....K.DL.A.TSTS.PQ.EL.T.G..RE.D......P.P | |
| Retrocopy | *PLVHPNKPKACTFSCEEKH*KLDLNAETSTS>PQKELLTQGRLREMDP*SSHSP*P |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 10 .87 RPM |
| SRP017611_kidney | 0 .10 RPM | 19 .05 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .05 RPM |
| SRP040447_lung | 0 .00 RPM | 26 .13 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 8 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008232 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000005352 | 2 retrocopies |
retro_cpor_749 , retro_cpor_892,
|
| Dipodomys ordii | ENSDORG00000007521 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000008873 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000024165 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000015551 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000016673 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000024661 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000012440 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000012700 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011377 | 1 retrocopy |