RetrogeneDB ID: | retro_dnov_1389 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_193151:1079..1459(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ZMYND19 | ||
| Ensembl ID: | ENSDNOG00000006644 | ||
| Aliases: | None | ||
| Description: | zinc finger, MYND-type containing 19 [Source:HGNC Symbol;Acc:21146] |
| Percent Identity: | 85.94 % |
| Parental protein coverage: | 55.75 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LQLVPWGW-PKAEETSSKQREQSLYWLAIQQLPTDPLEEQFPVLNVARYYN-ANGDVVEEEEGSCTYYEC |
| LQLV.WGW..KAEETSSKQ.EQSLYWLAIQQLP.DPLEE.FPVLNVARYY..ANGDVVEEEEGSCTYYEC | |
| Retrocopy | LQLVQWGWWSKAEETSSKQQEQSLYWLAIQQLPSDPLEEPFPVLNVARYYK<ANGDVVEEEEGSCTYYEC |
| Parental | RYPPCTAMEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCREKKRPFQHELEPER |
| .YPP.T.MEKQL.EFNIC.RCQVARYCGSQCQQKDWP.H.KHC.EKK.PFQHELE.ER | |
| Retrocopy | CYPPYTVMEKQLHEFNICRRCQVARYCGSQCQQKDWPDH*KHCHEKKCPFQHELELER |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 5 .25 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 6 .74 RPM |
| SRP012922_heart | 0 .00 RPM | 1 .86 RPM |
| SRP012922_kidney | 0 .00 RPM | 2 .46 RPM |
| SRP012922_liver | 0 .00 RPM | 2 .01 RPM |
| SRP012922_lung | 0 .00 RPM | 3 .21 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 2 .60 RPM |
| SRP012922_spleen | 0 .00 RPM | 5 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000006644 | 2 retrocopies |
retro_dnov_1389 , retro_dnov_1468,
|
| Dipodomys ordii | ENSDORG00000008360 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012412 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005023 | 1 retrocopy | |
| Homo sapiens | ENSG00000165724 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006875 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000011727 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019610 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017172 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026974 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009236 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010812 | 1 retrocopy |