RetrogeneDB ID: | retro_dnov_1451 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_20667:40584..40910(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TPD52 | ||
| Ensembl ID: | ENSDNOG00000017379 | ||
| Aliases: | None | ||
| Description: | tumor protein D52 [Source:HGNC Symbol;Acc:12005] |
| Percent Identity: | 64.1 % |
| Parental protein coverage: | 51.79 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | RDYREMDSYEDYKSPFDFDKGVNKNYLYLSPSGNSSPPGSPTLQKHGLLRTDSVPEEGEDVAAAISATEA |
| .DY...D.YEDYKSPFDFD....K.YLYL.PSGN.SPPGSP.LQK.GLL..D.V.EEGEDVAA.ISATE. | |
| Retrocopy | KDYSKIDLYEDYKSPFDFD----KSYLYLTPSGNLSPPGSPSLQKYGLL*ADPVLEEGEDVAATISATET |
| Parental | LSEEEQEELRRELAKVEEEIQTLSQ-VLAAKEKHLAEIKRKLGINSL |
| LSEE.Q.E....L......IQTLSQ...AAKEK.LAE.K.K..IN.. | |
| Retrocopy | LSEEKQKE---TLQR*KKKIQTLSQ<EVAAKEKLLAETKQKFRINRI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 171 .52 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 55 .40 RPM |
| SRP012922_heart | 0 .00 RPM | 2 .55 RPM |
| SRP012922_kidney | 0 .00 RPM | 141 .83 RPM |
| SRP012922_liver | 0 .00 RPM | 14 .09 RPM |
| SRP012922_lung | 0 .00 RPM | 8 .55 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .38 RPM |
| SRP012922_spleen | 0 .00 RPM | 19 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000014930 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017379 | 2 retrocopies |
retro_dnov_1294, retro_dnov_1451 ,
|
| Mus musculus | ENSMUSG00000027506 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008247 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016601 | 2 retrocopies |