RetrogeneDB ID: | retro_dnov_1613 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_2473:56485..56921(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000007283 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.76 % |
| Parental protein coverage: | 53.65 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | YGNREEQNLSDLLFPTFEGVNNVEQNAQENENESQLSTDESENSSKSPGNKPNNIKSKATTWNSFL-PPP |
| .GNR....LS.LL.P.FEGVNN.E.NA.ENENES...TDESENS..SPGNKP..IK.K...WNS...PP. | |
| Retrocopy | FGNRKIC-LSELLLPAFEGVNNIERNA*ENENESPITTDESENSYRSPGNKPYDIK*KMAPWNSYI>PPA |
| Parental | PPMPGSGLGPGKSGLKFNGPPPPPPPPFLSCWLPPLPSGPPILPPPPPICPDSFDDADALGSMLISWYMS |
| P.MPG....PGKS..........P....LSC.LPP...GPP....PPPI.PD.FD.A.A.GS..ISWYM. | |
| Retrocopy | P-MPGLESEPGKSCRVPCSRSSNPNTHVLSCRLPPSRFGPPRTLRPPPISPDTFDYAGAMGSV*ISWYMN |
| Parental | GYHTGYYL |
| G.HT.Y.L | |
| Retrocopy | G*HTVYNL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 15 .56 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 15 .26 RPM |
| SRP012922_heart | 0 .00 RPM | 7 .66 RPM |
| SRP012922_kidney | 0 .00 RPM | 8 .76 RPM |
| SRP012922_liver | 0 .00 RPM | 5 .88 RPM |
| SRP012922_lung | 0 .00 RPM | 11 .61 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 6 .40 RPM |
| SRP012922_spleen | 0 .00 RPM | 14 .77 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000012328 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007283 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000001406 | 2 retrocopies | |
| Homo sapiens | ENSG00000205571 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026704 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010603 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020214 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000004454 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017097 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016955 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000016970 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000012288 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002399 | 1 retrocopy |