RetrogeneDB ID: | retro_dnov_253 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_306:45219..45668(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MEMO1 | ||
| Ensembl ID: | ENSDNOG00000001254 | ||
| Aliases: | None | ||
| Description: | mediator of cell motility 1 [Source:HGNC Symbol;Acc:14014] |
| Percent Identity: | 81.7 % |
| Parental protein coverage: | 52.92 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | EFTIIPVLV-ALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHW-GQRFRYSYYDESQGEIYRSIEHLDK |
| EFTIIPVLV.ALS.SKEQEFGKLFSKYL.DPS..FVVSSDFCHW..QRF.YSYYDESQGEIYRS.EHL.K | |
| Retrocopy | EFTIIPVLVGALSDSKEQEFGKLFSKYLVDPSTRFVVSSDFCHW<DQRFHYSYYDESQGEIYRSTEHLNK |
| Parental | -MGMS-IEQLDPVSFSNYLKKYHNTICGRH-PIGVL---LNAITELQKNGMNMSFSFLNYAQSSQCRNWQ |
| .MGMS.IEQ.DPVS.SNYLKK.HN.I.GRH.P.G.....LNAITELQKNGMNM.FS.LNYAQSSQCRNWQ | |
| Retrocopy | <MGMSFIEQ*DPVSCSNYLKKCHNKIYGRH>PLGCFLLGLNAITELQKNGMNMNFSLLNYAQSSQCRNWQ |
| Parental | DSSVSYAAGALTV |
| DSSVS.AAGAL.V | |
| Retrocopy | DSSVSCAAGALAV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 10 .70 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 3 .30 RPM |
| SRP012922_heart | 0 .00 RPM | 9 .51 RPM |
| SRP012922_kidney | 0 .00 RPM | 11 .50 RPM |
| SRP012922_liver | 0 .00 RPM | 2 .32 RPM |
| SRP012922_lung | 0 .00 RPM | 7 .03 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 24 .58 RPM |
| SRP012922_spleen | 0 .00 RPM | 21 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012339 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000012278 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001254 | 1 retrocopy |
retro_dnov_253 ,
|
| Oryctolagus cuniculus | ENSOCUG00000005878 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000011427 | 1 retrocopy |