RetrogeneDB ID: | retro_dnov_257 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_3069:95398..95633(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ZCCHC10 | ||
Ensembl ID: | ENSDNOG00000017302 | ||
Aliases: | None | ||
Description: | zinc finger, CCHC domain containing 10 [Source:HGNC Symbol;Acc:25954] |
Percent Identity: | 63.41 % |
Parental protein coverage: | 70.8 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | EANKQHVRCQ-KCLEFGHWTYECTGK-RKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVEKKTKKKR |
EA.KQH.R.Q..CL.FGHW.YEC.GK.RKYL.RPSR..ELKKALKE.E.R.LL.QSIGE.NV........ | |
Retrocopy | EAHKQHIRYQ<ECL*FGHWPYECVGK<RKYLYRPSRIPELKKALKERESR-LL*QSIGEPNVXXXXXXXX |
Parental | SSVSSSSNSSGS |
S....SSNS.GS | |
Retrocopy | SKHVTSSNSNGS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 2 .14 RPM |
SRP012922_cerebellum | 0 .00 RPM | 1 .79 RPM |
SRP012922_heart | 0 .00 RPM | 1 .62 RPM |
SRP012922_kidney | 0 .00 RPM | 0 .82 RPM |
SRP012922_liver | 0 .00 RPM | 0 .46 RPM |
SRP012922_lung | 0 .15 RPM | 1 .53 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 1 .21 RPM |
SRP012922_spleen | 0 .00 RPM | 2 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000031203 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001420 | 9 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000017302 | 1 retrocopy |
retro_dnov_257 ,
|
Myotis lucifugus | ENSMLUG00000011366 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000013827 | 1 retrocopy | |
Mus musculus | ENSMUSG00000018239 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000032171 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015776 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000006943 | 3 retrocopies | |
Sorex araneus | ENSSARG00000007221 | 1 retrocopy |