RetrogeneDB ID: | retro_dnov_257 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_3069:95398..95633(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ZCCHC10 | ||
| Ensembl ID: | ENSDNOG00000017302 | ||
| Aliases: | None | ||
| Description: | zinc finger, CCHC domain containing 10 [Source:HGNC Symbol;Acc:25954] |
| Percent Identity: | 63.41 % |
| Parental protein coverage: | 70.8 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | EANKQHVRCQ-KCLEFGHWTYECTGK-RKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVEKKTKKKR |
| EA.KQH.R.Q..CL.FGHW.YEC.GK.RKYL.RPSR..ELKKALKE.E.R.LL.QSIGE.NV........ | |
| Retrocopy | EAHKQHIRYQ<ECL*FGHWPYECVGK<RKYLYRPSRIPELKKALKERESR-LL*QSIGEPNVXXXXXXXX |
| Parental | SSVSSSSNSSGS |
| S....SSNS.GS | |
| Retrocopy | SKHVTSSNSNGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .14 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 1 .79 RPM |
| SRP012922_heart | 0 .00 RPM | 1 .62 RPM |
| SRP012922_kidney | 0 .00 RPM | 0 .82 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .46 RPM |
| SRP012922_lung | 0 .15 RPM | 1 .53 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .21 RPM |
| SRP012922_spleen | 0 .00 RPM | 2 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000031203 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001420 | 9 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000017302 | 1 retrocopy |
retro_dnov_257 ,
|
| Myotis lucifugus | ENSMLUG00000011366 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000013827 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000018239 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000032171 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015776 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000006943 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000007221 | 1 retrocopy |