RetrogeneDB ID: | retro_dnov_710 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_100470:388..804(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | THEM4 | ||
Ensembl ID: | ENSDNOG00000005970 | ||
Aliases: | None | ||
Description: | thioesterase superfamily member 4 [Source:HGNC Symbol;Acc:17947] |
Percent Identity: | 64.08 % |
Parental protein coverage: | 97.89 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | EGKQRSQAPFFTRSFEDGLGFENAIFYNEDEKRAVCSFQGGPYLQGARGFLHGGTTSTMIDNTLSVYA-L |
EGKQ.SQA..FTRSFE.GL.FE..IFYNEDEK..VC.F.GG.YL.G..GF.H.GTT.T.ID.T....A.L | |
Retrocopy | EGKQCSQAYLFTRSFEGGLSFEYVIFYNEDEKKIVCLFHGGTYLCGVPGFFHEGTTATLIDITFGMCA<L |
Parental | LSGE-FAMTANLNINFKRPIPLNSVVVINGQLDKIEGREVFLSYSVQSVDEKILYS-EATSIFVQLDPDK |
..GE..AMT.NL.INF.R.I...SVVV.N.QLDK.EGR..F.S....SV..KILYS.EATS.FV.LDPDK | |
Retrocopy | QLGE<IAMTTNLIINFRRHISFCSVVVRNSQLDKVEGRKRFVSCNI*SVHKKILYS>EATSFFVKLDPDK |
Parental | SL |
SL | |
Retrocopy | SL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 25 .86 RPM |
SRP012922_cerebellum | 0 .00 RPM | 15 .26 RPM |
SRP012922_heart | 0 .00 RPM | 15 .78 RPM |
SRP012922_kidney | 0 .00 RPM | 20 .81 RPM |
SRP012922_liver | 0 .00 RPM | 10 .53 RPM |
SRP012922_lung | 0 .00 RPM | 6 .41 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 17 .65 RPM |
SRP012922_spleen | 0 .00 RPM | 7 .33 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000355 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000818 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000005970 | 1 retrocopy |
retro_dnov_710 ,
|
Felis catus | ENSFCAG00000003443 | 1 retrocopy | |
Homo sapiens | ENSG00000159445 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000008114 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000010696 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010322 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000005194 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000851 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001301 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000003352 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000005739 | 1 retrocopy |