RetrogeneDB ID: | retro_ggor_782 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:22287480..22287915(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | THEM4 | ||
Ensembl ID: | ENSGGOG00000008114 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 95.86 % |
Parental protein coverage: | 60.42 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | DPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVG |
DPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYND.EKRMVCLFQG.PYLEGPPGF.HGGAIATMIDATVG | |
Retrocopy | DPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDVEKRMVCLFQGVPYLEGPPGFVHGGAIATMIDATVG |
Parental | MCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNP |
MCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKT.YSEATS.FIKLNP | |
Retrocopy | MCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTSYSEATSVFIKLNP |
Parental | DKSLT |
.KSLT | |
Retrocopy | AKSLT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .06 RPM |
SRP007412_cerebellum | 0 .00 RPM | 12 .10 RPM |
SRP007412_heart | 0 .00 RPM | 6 .44 RPM |
SRP007412_kidney | 0 .04 RPM | 34 .43 RPM |
SRP007412_liver | 0 .00 RPM | 9 .65 RPM |
SRP007412_testis | 0 .00 RPM | 37 .61 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_978 |
Pan troglodytes | retro_ptro_768 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000355 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000818 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000005970 | 1 retrocopy | |
Felis catus | ENSFCAG00000003443 | 1 retrocopy | |
Homo sapiens | ENSG00000159445 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000008114 | 2 retrocopies |
retro_ggor_1195, retro_ggor_782 ,
|
Microcebus murinus | ENSMICG00000010696 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010322 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000005194 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000851 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001301 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000003352 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000005739 | 1 retrocopy |