RetrogeneDB ID: | retro_dnov_928 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_122688:4670..4889(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SVIP | ||
Ensembl ID: | ENSDNOG00000016735 | ||
Aliases: | None | ||
Description: | small VCP/p97-interacting protein [Source:HGNC Symbol;Acc:25238] |
Percent Identity: | 73.97 % |
Parental protein coverage: | 96.05 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MGLCFPCPGEAEPPSPDPEEKRAKLAEAAERRQREAASRGILNVQSVEEKRKKKERLEKQITTTGPPPEG |
MGLCFPCPGEAEPPS.DPEEKR.KLAEA.ERRQR.AASRGIL.VQSV..............TTTGPPPEG | |
Retrocopy | MGLCFPCPGEAEPPSADPEEKRTKLAEATERRQR*AASRGILDVQSVXXXXXXXXXXXXXXTTTGPPPEG |
Parental | GLR |
GLR | |
Retrocopy | GLR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 2 .53 RPM |
SRP012922_cerebellum | 0 .14 RPM | 9 .62 RPM |
SRP012922_heart | 0 .00 RPM | 6 .03 RPM |
SRP012922_kidney | 0 .00 RPM | 5 .75 RPM |
SRP012922_liver | 0 .00 RPM | 2 .63 RPM |
SRP012922_lung | 0 .00 RPM | 7 .64 RPM |
SRP012922_quadricep_muscle | 0 .17 RPM | 9 .87 RPM |
SRP012922_spleen | 0 .00 RPM | 7 .10 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000013152 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000016735 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000022838 | 1 retrocopy |