RetrogeneDB ID: | retro_dnov_997 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_132344:546..776(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO1 | ||
| Ensembl ID: | ENSDNOG00000015868 | ||
| Aliases: | None | ||
| Description: | small ubiquitin-like modifier 1 [Source:HGNC Symbol;Acc:12502] |
| Percent Identity: | 80.77 % |
| Parental protein coverage: | 68.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | DQEAKPSTEDLGDKKEG-EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRI |
| ..EAK.STEDLGDK....EYI..KVIGQDSS..HFKVKMT.HLKKLKESYCQRQGV.MNSL.FLFEGQRI | |
| Retrocopy | NREAKHSTEDLGDKEKR<EYITQKVIGQDSSYSHFKVKMTAHLKKLKESYCQRQGVLMNSLKFLFEGQRI |
| Parental | ADNHTPKE |
| .DNHTPKE | |
| Retrocopy | TDNHTPKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .33 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 2 .34 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .93 RPM |
| SRP012922_kidney | 0 .00 RPM | 3 .29 RPM |
| SRP012922_liver | 0 .15 RPM | 1 .39 RPM |
| SRP012922_lung | 0 .00 RPM | 3 .36 RPM |
| SRP012922_quadricep_muscle | 0 .17 RPM | 0 .69 RPM |
| SRP012922_spleen | 0 .11 RPM | 2 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013225 | 5 retrocopies | |
| Bos taurus | ENSBTAG00000009859 | 6 retrocopies | |
| Canis familiaris | ENSCAFG00000012431 | 8 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000015868 | 10 retrocopies |
retro_dnov_1070, retro_dnov_1324, retro_dnov_1610, retro_dnov_1623, retro_dnov_1826, retro_dnov_1876, retro_dnov_2068, retro_dnov_2330, retro_dnov_2423, retro_dnov_997 ,
|
| Felis catus | ENSFCAG00000031005 | 6 retrocopies | |
| Loxodonta africana | ENSLAFG00000022855 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007504 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030345 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013083 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012817 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000011968 | 1 retrocopy |