RetrogeneDB ID: | retro_ecab_236 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 10:28617296..28617464(-) | ||
| Located in intron of: | ENSECAG00000023066 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSECAG00000005108 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_ecab_236
ATGAGTAACAGCACAGTTCCCAGTGCCCTCCGGGTCAACAGAGACTCCACGGTGGGCTACATGCTGGGGCCTTTCTTCCT
CATCCCCTCGGTCGGGCTGGTTGCGGCTGTGGCAATGTATGTCCAGAAGAAAAAGGGGGTGGACGGGCTTCGCCATCACC
TGCTCCCC
ORF - retro_ecab_236 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 54.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | MRNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLP |
| M.N.TVP.A...N.DS.VGY.LGPFFLI..VG.V.AV.MYVQKKK.VD.LRHHLLP | |
| Retrocopy | MSNSTVPSALRVNRDSTVGYMLGPFFLIPSVGLVAAVAMYVQKKKGVDGLRHHLLP |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 1 .30 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 10 .65 RPM |
| SRP021940_embryo | 0 .00 RPM | 2 .25 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 5 .10 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 3 .68 RPM |
| SRP021940_testis | 0 .00 RPM | 3 .26 RPM |
Equus caballus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_ecab_236 retrocopy.
Equus caballus was not studied using FANTOM5 data.
retro_ecab_236 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_ecab_236 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 7 parental genes, and 9 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001058 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000034519 | 1 retrocopy | |
| Equus caballus | ENSECAG00000005108 | 3 retrocopies |
retro_ecab_236 , retro_ecab_474, retro_ecab_700,
|
| Myotis lucifugus | ENSMLUG00000011876 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062753 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013398 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000004692 | 1 retrocopy |