RetrogeneDB ID: | retro_ecab_720 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 3:61904142..61904475(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C11orf73 | ||
| Ensembl ID: | ENSECAG00000015605 | ||
| Aliases: | None | ||
| Description: | chromosome 11 open reading frame 73 [Source:HGNC Symbol;Acc:26938] |
| Percent Identity: | 58.97 % |
| Parental protein coverage: | 58.38 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | KISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQK-MLDNFYN |
| KI..LKSGEGS.HP.GAMNIV.TPSVA.IGIS..L....A....VG.AA.S..DSFTQ...K....N.Y. | |
| Retrocopy | KIACLKSGEGSRHPSGAMNIVQTPSVALIGISADLQTQTA----VGDAADSLADSFTQPSMK<TWGNVYC |
| Parental | FASSFAVSQAQMTPSPSEMFIPANV-VLKWYENFQRRLAQNPLFWKT |
| .ASSFA.S.A.MTP.PSE.FIPA.......YENFQR.L...PL..KT | |
| Retrocopy | SASSFALSEA*MTPNPSEFFIPASE>LSQRYENFQR*LTLSPLL*KT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 7 .73 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 13 .40 RPM |
| SRP021940_embryo | 0 .00 RPM | 18 .62 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 14 .96 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 11 .12 RPM |
| SRP021940_testis | 0 .06 RPM | 8 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000015605 | 1 retrocopy |
retro_ecab_720 ,
|
| Homo sapiens | ENSG00000149196 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023168 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016260 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062797 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016224 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013108 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000003746 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000004144 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000009192 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000012267 | 1 retrocopy |