RetrogeneDB ID: | retro_ecab_872 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 6:18101265..18101503(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BIK | ||
| Ensembl ID: | ENSECAG00000018135 | ||
| Aliases: | None | ||
| Description: | BCL2-interacting killer (apoptosis-inducing) [Source:HGNC Symbol;Acc:1051] |
Retrocopy-Parental alignment summary:
>retro_ecab_872
ATGTCTCAAGCAGGCTCCCTCTCCAGGGACCTCTTTTTGGACACCTTCCTGTGTGAGCATGTTCTGGAACCTGAGGAGGT
TCCTGGCACGATCGATCTCACGGACTACGTTGACCGTGAGTCCTCCCCCGACAGTGACAACCCCGACGACGTTGCCCTGC
AGCTGGCCTTCATCATGACGAGAAAGAATTGTCATGGATGCTGCTCACCTTGCTCAGCTGCCCCAGATGGCCATGTAC
ORF - retro_ecab_872 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 52.44 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
Retrocopy - Parental Gene Alignment:
| Parental | MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTDSQSPSPQGEGDNRDSVAMRLAFI-GDEMEVRWML- |
| MSQ.G..SRDLFLD.FL.E...E..EVPG...LTD..........DN.D.VA..LAFI..DE.E..WML. | |
| Retrocopy | MSQAGSLSRDLFLDTFLCEHVLEPEEVPGTIDLTDYVDRESSPDSDNPDDVALQLAFI<HDEKELSWML< |
| Parental | PHIAELPGVAVY |
| .H.A.LP..A.Y | |
| Retrocopy | AHLAQLPQMAMY |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 0 .12 RPM |
| SRP021940_cerebellum | 0 .05 RPM | 0 .05 RPM |
| SRP021940_embryo | 0 .00 RPM | 0 .31 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 1 .01 RPM |
| SRP021940_synovial_membrane | 0 .03 RPM | 0 .33 RPM |
| SRP021940_testis | 0 .00 RPM | 2 .69 RPM |
Equus caballus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_ecab_872 retrocopy.
Equus caballus was not studied using FANTOM5 data.
retro_ecab_872 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_ecab_872 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 2 parental genes, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000018135 | 1 retrocopy |
retro_ecab_872 ,
|
| Felis catus | ENSFCAG00000012125 | 1 retrocopy |