RetrogeneDB ID: | retro_etel_1328 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_247557:3181..3434(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MGST3 | ||
| Ensembl ID: | ENSETEG00000003507 | ||
| Aliases: | None | ||
| Description: | microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:7064] |
| Percent Identity: | 70.59 % |
| Parental protein coverage: | 71.79 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | FIMVAHLAINVAKARKKYKVEYPTMYSTDPENGHLFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIV-S |
| F.M.AH.AI..AKARKKY.V.YPTMYSTDP.NGH.FNCIQR.H..TLEV.P.FLFFLAVGG..HP..V.S | |
| Retrocopy | FVMAAHVAISIAKARKKYRVQYPTMYSTDPKNGHFFNCIQRTHRDTLEVSPTFLFFLAVGGMDHPCAV>S |
| Parental | GLGLAWIVGRVLYAY |
| GLGL..IV.R.L.A. | |
| Retrocopy | GLGLS*IVRRILHAW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006658 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013353 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012723 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000003507 | 3 retrocopies |
retro_etel_1328 , retro_etel_1527, retro_etel_1544,
|
| Mustela putorius furo | ENSMPUG00000003817 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026688 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000010376 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000015774 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004245 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005299 | 2 retrocopies |