RetrogeneDB ID: | retro_etel_223 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | GeneScaffold_3813:91569..91935(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS24 | ||
Ensembl ID: | ENSETEG00000007481 | ||
Aliases: | None | ||
Description: | ribosomal protein S24 [Source:HGNC Symbol;Acc:10411] |
Percent Identity: | 73.39 % |
Parental protein coverage: | 90.84 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MNDTVTIRTRKFMTN-RLLQRKQMVIDVLHPGK-ATVPKTEIR-EKLAKMYKTTPDVIFVFGFRTHFGGG |
MND..T..T.KFMTN..L.Q..QMVI.VLHPGK.ATVPKT.I...KLAKMYKTTPDVIF.FG..THFG.. | |
Retrocopy | MNDPETPWTSKFMTNYQLPQ*TQMVIAVLHPGK>ATVPKTKIHLKKLAKMYKTTPDVIFLFGLSTHFGDA |
Parental | -KTTGFGMIYDSLD-YKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT |
.KTT.FGMIYDSLD..KK.EPKHRLARHGLYE..KTS..Q.KE.KNRMKK.RGT | |
Retrocopy | <KTTDFGMIYDSLDDAKKTEPKHRLARHGLYET*KTSGTQHKECKNRMKKTRGT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000010243 | 18 retrocopies | |
Echinops telfairi | ENSETEG00000007481 | 32 retrocopies |
retro_etel_1119, retro_etel_1242, retro_etel_1274, retro_etel_1339, retro_etel_1395, retro_etel_1663, retro_etel_1688, retro_etel_1783, retro_etel_1800, retro_etel_1806, retro_etel_183, retro_etel_1901, retro_etel_1934, retro_etel_1978, retro_etel_1991, retro_etel_2040, retro_etel_2104, retro_etel_223 , retro_etel_287, retro_etel_289, retro_etel_369, retro_etel_422, retro_etel_476, retro_etel_503, retro_etel_523, retro_etel_67, retro_etel_744, retro_etel_752, retro_etel_815, retro_etel_904, retro_etel_91, retro_etel_94,
|
Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000025091 | 3 retrocopies | |
Ornithorhynchus anatinus | ENSOANG00000006329 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000008090 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000010328 | 8 retrocopies |