RetrogeneDB ID: | retro_fcat_1987 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | X:53133056..53133275(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ZNRF2 | ||
| Ensembl ID: | ENSFCAG00000026521 | ||
| Aliases: | None | ||
| Description: | zinc and ring finger 2 [Source:HGNC Symbol;Acc:22316] |
Retrocopy-Parental alignment summary:
>retro_fcat_1987
GTACCCTCACATGAAATGGGTATGCATGATGTGATGTGTTGAAGAAAGCCAAGACTAAGCCATAATGAGGATGTACTGAG
TAAAGATGCTGGCCAGTGTGCAGTATGCTTGAAAAAATGCAGAGGGAGGTACTATAGCAGGGTTGCCTTGTCTATTCATA
TATCATTAAGGTTGCACTGGTTTAAAATAAATAGATCTTGCCCTGAGCATCTTTCAGAT
ORF - retro_fcat_1987 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 59.49 % |
| Parental protein coverage: | 81.72 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
Retrocopy - Parental Gene Alignment:
| Parental | VPSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICL-EELQ-QGDTIARLPCLCIY-HKGCIDEWFEVN |
| VPS.EM..H.VMC..KPR...NEDVLSKDAG.CA.CL.E..Q..G.TIA.LP..C...H......WF..N | |
| Retrocopy | VPSHEMGMHDVMC*RKPRLSHNEDVLSKDAGQCAVCL<EKMQ<EGGTIAGLP--CLF<HISLRLHWFKIN |
| Parental | RSCPEHPSD |
| RSCPEH.SD | |
| Retrocopy | RSCPEHLSD |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 3 .44 RPM |
| SRP017611_kidney | 0 .00 RPM | 14 .33 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .86 RPM |
Felis catus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_fcat_1987 retrocopy.
Felis catus was not studied using FANTOM5 data.
retro_fcat_1987 was not experimentally validated.
Retrocopy orthology:
Felis catus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 2 parental genes, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000027612 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026521 | 1 retrocopy |
retro_fcat_1987 ,
|